General Information

  • ID:  hor006406
  • Uniprot ID:  P21780
  • Protein name:  somatostatin-28
  • Gene name:  sst2
  • Organism:  Platichthys flesus (European flounder) (Pleuronectes flesus)
  • Family:  Somatostatin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Platichthys (genus), Pleuronectidae (family), Pleuronectoidei (suborder), Pleuronectiformes (order), Carangaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  SIEPPNNLPPRERKAGCKNFYWKGFTSC
  • Length:  28(46-73)
  • Propeptide:  SAGLLTQEWSAVEDLLAQMSLPEADAQRDAEMVSTATGGGRMNQESIEPPNNLPPRERKAGCKNFYWKGFTSC
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Somatostatin inhibits the release of somatotropin.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  17-28
  • Structure ID:  AF-P21780-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006406_AF2.pdbhor006406_ESM.pdb

Physical Information

Mass: 372245 Formula: C145H219N41O40S2
Absent amino acids: DHMQV Common amino acids: P
pI: 9.46 Basic residues: 5
Polar residues: 11 Hydrophobic residues: 6
Hydrophobicity: -104.29 Boman Index: -6516
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 31.43
Instability Index: 6133.93 Extinction Coefficient cystines: 7115
Absorbance 280nm: 263.52

Literature

  • PubMed ID:  2889597
  • Title:  Structural characterization of peptides derived from prosomatostatins I and II isolated from the pancreatic islets of two species of teleostean fish: the daddy sculpin and the flounder.